Anti GPA33 pAb (ATL-HPA018858 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018858-25

• 
• 

Protein Description: glycoprotein A33 (transmembrane)
Gene Name: GPA33
Alternative Gene Name: A33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000544: 75%, ENSRNOG00000003740: 78%
Entrez Gene ID: 10223
Uniprot ID: Q99795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVA
• Gene Sequence: TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVA
• Gene ID - Mouse: ENSMUSG00000000544
• Gene ID - Rat: ENSRNOG00000003740
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPA33 pAb (ATL-HPA018858 w/enhanced validation) – 3 Found

Chen, Huanhuan Joyce; Wei, Zhubo; Sun, Jian; Bhattacharya, Asmita; Savage, David J; Serda, Rita; Mackeyev, Yuri; Curley, Steven A; Bu, Pengcheng; Wang, Lihua; Chen, Shuibing; Cohen-Gould, Leona; Huang, Emina; Shen, Xiling; Lipkin, Steven M; Copeland, Neal G; Jenkins, Nancy A; Shuler, Michael L. A recellularized human colon model identifies cancer driver genes. Nature Biotechnology. 2016;34(8):845-51. 

Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. 

Katsukura, Nobuhiro; Watanabe, Sho; Shirasaki, Tomoaki; Hibiya, Shuji; Kano, Yoshihito; Akahoshi, Keiichi; Tanabe, Minoru; Kirimura, Susumu; Akashi, Takumi; Kitagawa, Masanobu; Okamoto, Ryuichi; Watanabe, Mamoru; Tsuchiya, Kiichiro. Intestinal phenotype is maintained by Atoh1 in the cancer region of intraductal papillary mucinous neoplasm. Cancer Science. 2021;112(2):932-944.