Anti GP2 pAb (ATL-HPA016668 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA016668-25

• 

Protein Description: glycoprotein 2 (zymogen granule membrane)
Gene Name: GP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030954: 62%, ENSRNOG00000015716: 63%
Entrez Gene ID: 2813
Uniprot ID: P55259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
• Gene Sequence: NPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCT
• Gene ID - Mouse: ENSMUSG00000030954
• Gene ID - Rat: ENSRNOG00000015716
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GP2 pAb (ATL-HPA016668 w/enhanced validation) – 3 Found

Baldan, Jonathan; Houbracken, Isabelle; Rooman, Ilse; Bouwens, Luc. Adult human pancreatic acinar cells dedifferentiate into an embryonic progenitor-like state in 3D suspension culture. Scientific Reports. 2019;9(1):4040. 

Muraoka, Satoshi; Kume, Hideaki; Watanabe, Shio; Adachi, Jun; Kuwano, Masayoshi; Sato, Misako; Kawasaki, Naoko; Kodera, Yoshio; Ishitobi, Makoto; Inaji, Hideo; Miyamoto, Yasuhide; Kato, Kikuya; Tomonaga, Takeshi. Strategy for SRM-based verification of biomarker candidates discovered by iTRAQ method in limited breast cancer tissue samples. Journal Of Proteome Research. 2012;11(8):4201-10. 

Tsuruta, Satoru; Kawasaki, Tomoyuki; Machida, Masakazu; Iwatsuki, Ken; Inaba, Akihiko; Shibata, Shinsuke; Shindo, Tomoko; Nakabayashi, Kazuhiko; Hakamada, Kenichi; Umezawa, Akihiro; Akutsu, Hidenori. Development of Human Gut Organoids With Resident Tissue Macrophages as a Model of Intestinal Immune Responses. Cellular And Molecular Gastroenterology And Hepatology. 14(3):726-729.e5.