Anti GOT1L1 pAb (ATL-HPA028778)

Atlas Antibodies

Catalog No.:
ATL-HPA028778-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glutamic-oxaloacetic transaminase 1-like 1
Gene Name: GOT1L1
Alternative Gene Name: MGC33309
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039720: 79%, ENSRNOG00000038473: 83%
Entrez Gene ID: 137362
Uniprot ID: Q8NHS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRVCMTNEGHPWVSLVVQKTRLQISQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGD
Gene Sequence YRVCMTNEGHPWVSLVVQKTRLQISQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGD
Gene ID - Mouse ENSMUSG00000039720
Gene ID - Rat ENSRNOG00000038473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GOT1L1 pAb (ATL-HPA028778)
Datasheet Anti GOT1L1 pAb (ATL-HPA028778) Datasheet (External Link)
Vendor Page Anti GOT1L1 pAb (ATL-HPA028778) at Atlas Antibodies

Documents & Links for Anti GOT1L1 pAb (ATL-HPA028778)
Datasheet Anti GOT1L1 pAb (ATL-HPA028778) Datasheet (External Link)
Vendor Page Anti GOT1L1 pAb (ATL-HPA028778)