Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035275-25

• 
• 
• 

Protein Description: golgi reassembly stacking protein 2, 55kDa
Gene Name: GORASP2
Alternative Gene Name: GOLPH6, GRASP55, GRS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014959: 92%, ENSRNOG00000055853: 88%
Entrez Gene ID: 26003
Uniprot ID: Q9H8Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
• Gene Sequence: PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
• Gene ID - Mouse: ENSMUSG00000014959
• Gene ID - Rat: ENSRNOG00000055853
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) – 2 Found

Wiersma, Vera I; van Ziel, Anna Maria; Vazquez-Sanchez, Sonia; Nölle, Anna; Berenjeno-Correa, Ernesto; Bonaterra-Pastra, Anna; Clavaguera, Florence; Tolnay, Markus; Musters, René J P; van Weering, Jan R T; Verhage, Matthijs; Hoozemans, Jeroen J M; Scheper, Wiep. Granulovacuolar degeneration bodies are neuron-selective lysosomal structures induced by intracellular tau pathology. Acta Neuropathologica. 2019;138(6):943-970. 

Moriggi, Manuela; Capitanio, Daniele; Torretta, Enrica; Barbacini, Pietro; Bragato, Cinzia; Sartori, Patrizia; Moggio, Maurizio; Maggi, Lorenzo; Mora, Marina; Gelfi, Cecilia. Muscle Proteomic Profile before and after Enzyme Replacement Therapy in Late-Onset Pompe Disease. International Journal Of Molecular Sciences. 2021;22(6)