Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035275-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GORASP2
Alternative Gene Name: GOLPH6, GRASP55, GRS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014959: 92%, ENSRNOG00000055853: 88%
Entrez Gene ID: 26003
Uniprot ID: Q9H8Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV |
Gene Sequence | PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV |
Gene ID - Mouse | ENSMUSG00000014959 |
Gene ID - Rat | ENSRNOG00000055853 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) | |
Datasheet | Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) | |
Datasheet | Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) |
Citations for Anti GORASP2 pAb (ATL-HPA035275 w/enhanced validation) – 2 Found |
Wiersma, Vera I; van Ziel, Anna Maria; Vazquez-Sanchez, Sonia; Nölle, Anna; Berenjeno-Correa, Ernesto; Bonaterra-Pastra, Anna; Clavaguera, Florence; Tolnay, Markus; Musters, René J P; van Weering, Jan R T; Verhage, Matthijs; Hoozemans, Jeroen J M; Scheper, Wiep. Granulovacuolar degeneration bodies are neuron-selective lysosomal structures induced by intracellular tau pathology. Acta Neuropathologica. 2019;138(6):943-970. PubMed |
Moriggi, Manuela; Capitanio, Daniele; Torretta, Enrica; Barbacini, Pietro; Bragato, Cinzia; Sartori, Patrizia; Moggio, Maurizio; Maggi, Lorenzo; Mora, Marina; Gelfi, Cecilia. Muscle Proteomic Profile before and after Enzyme Replacement Therapy in Late-Onset Pompe Disease. International Journal Of Molecular Sciences. 2021;22(6) PubMed |