Anti GOPC pAb (ATL-HPA024018 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024018-100

• 
• 
• 

Protein Description: golgi-associated PDZ and coiled-coil motif containing
Gene Name: GOPC
Alternative Gene Name: CAL, dJ94G16.2, FIG, GOPC1, PIST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019861: 79%, ENSRNOG00000000408: 78%
Entrez Gene ID: 57120
Uniprot ID: Q9HD26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY
• Gene Sequence: IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY
• Gene ID - Mouse: ENSMUSG00000019861
• Gene ID - Rat: ENSRNOG00000000408
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.