Anti GOLPH3 pAb (ATL-HPA044564)
Atlas Antibodies
- SKU:
- ATL-HPA044564-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GOLPH3
Alternative Gene Name: GOPP1, GPP34, MIDAS, Vps74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022200: 100%, ENSRNOG00000012186: 100%
Entrez Gene ID: 64083
Uniprot ID: Q9H4A6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
| Gene Sequence | HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
| Gene ID - Mouse | ENSMUSG00000022200 |
| Gene ID - Rat | ENSRNOG00000012186 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GOLPH3 pAb (ATL-HPA044564) | |
| Datasheet | Anti GOLPH3 pAb (ATL-HPA044564) Datasheet (External Link) |
| Vendor Page | Anti GOLPH3 pAb (ATL-HPA044564) at Atlas Antibodies |
| Documents & Links for Anti GOLPH3 pAb (ATL-HPA044564) | |
| Datasheet | Anti GOLPH3 pAb (ATL-HPA044564) Datasheet (External Link) |
| Vendor Page | Anti GOLPH3 pAb (ATL-HPA044564) |
| Citations for Anti GOLPH3 pAb (ATL-HPA044564) – 1 Found |
| Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401. PubMed |