Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002315-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GOLIM4
Alternative Gene Name: GIMPC, GOLPH4, GPP130, P138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034109: 81%, ENSRNOG00000024213: 82%
Entrez Gene ID: 27333
Uniprot ID: O00461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ |
| Gene Sequence | ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ |
| Gene ID - Mouse | ENSMUSG00000034109 |
| Gene ID - Rat | ENSRNOG00000024213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) | |
| Datasheet | Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) | |
| Datasheet | Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) |
| Citations for Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |