Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002315-25

Protein Description: golgi integral membrane protein 4
Gene Name: GOLIM4
Alternative Gene Name: GIMPC, GOLPH4, GPP130, P138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034109: 81%, ENSRNOG00000024213: 82%
Entrez Gene ID: 27333
Uniprot ID: O00461
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
• Gene Sequence: ENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQ
• Gene ID - Mouse: ENSMUSG00000034109
• Gene ID - Rat: ENSRNOG00000024213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GOLIM4 pAb (ATL-HPA002315 w/enhanced validation) – 1 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.