Anti GOLGB1 pAb (ATL-HPA011555 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA011555-25
  • Immunohistochemical staining of human endometrium, gastrointestinal, kidney and prostate using Anti-GOLGB1 antibody HPA011555 (A) shows similar protein distribution across tissues to independent antibody HPA011008 (B).
  • Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: golgin B1
Gene Name: GOLGB1
Alternative Gene Name: GCP, GCP372, giantin, GOLIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034243: 69%, ENSRNOG00000030314: 67%
Entrez Gene ID: 2804
Uniprot ID: Q14789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGTVLPTEPQSEEQLSKHD
Gene Sequence RLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGTVLPTEPQSEEQLSKHD
Gene ID - Mouse ENSMUSG00000034243
Gene ID - Rat ENSRNOG00000030314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GOLGB1 pAb (ATL-HPA011555 w/enhanced validation)
Datasheet Anti GOLGB1 pAb (ATL-HPA011555 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOLGB1 pAb (ATL-HPA011555 w/enhanced validation)