Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA011008-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GOLGB1
Alternative Gene Name: GCP, GCP372, giantin, GOLIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034243: 60%, ENSRNOG00000030314: 63%
Entrez Gene ID: 2804
Uniprot ID: Q14789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS |
Gene Sequence | KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELS |
Gene ID - Mouse | ENSMUSG00000034243 |
Gene ID - Rat | ENSRNOG00000030314 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) | |
Datasheet | Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) | |
Datasheet | Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) |
Citations for Anti GOLGB1 pAb (ATL-HPA011008 w/enhanced validation) – 12 Found |
Wong, Mie; Gillingham, Alison K; Munro, Sean. The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs. Bmc Biology. 2017;15(1):3. PubMed |
Jung, Jinsei; Choi, Hyun Been; Koh, Young Ik; Rim, John Hoon; Choi, Hye Ji; Kim, Sung Huhn; Lee, Jae Hyun; An, Jieun; Kim, Ami; Lee, Joon Suk; Joo, Sun Young; Yu, Seyoung; Choi, Jae Young; Kang, Tong Mook; Gee, Heon Yung. Whole-exome sequencing identifies two novel mutations in KCNQ4 in individuals with nonsyndromic hearing loss. Scientific Reports. 2018;8(1):16659. PubMed |
Drouin, Aurélie; Migraine, Julie; Durand, Marie-Alice; Moreau, Alain; Burlaud-Gaillard, Julien; Beretta, Maxime; Roingeard, Philippe; Bouvin-Pley, Mélanie; Braibant, Martine. Escape of HIV-1 envelope glycoprotein from the restriction of infection by IFITM3. Journal Of Virology. 2021;95(5) PubMed |
Klemm, Lucas C; Denu, Ryan A; Hind, Laurel E; Rocha-Gregg, Briana L; Burkard, Mark E; Huttenlocher, Anna. Centriole and Golgi microtubule nucleation are dispensable for the migration of human neutrophil-like cells. Molecular Biology Of The Cell. 2021;32(17):1545-1556. PubMed |
Venditti, Massimo; Minucci, Sergio. Differential Expression and Localization of EHBP1L1 during the First Wave of Rat Spermatogenesis Suggest Its Involvement in Acrosome Biogenesis. Biomedicines. 2022;10(1) PubMed |
Rosa-Ferreira, Cláudia; Munro, Sean. Arl8 and SKIP act together to link lysosomes to kinesin-1. Developmental Cell. 2011;21(6):1171-8. PubMed |
Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898. PubMed |
Lovric, Svjetlana; Goncalves, Sara; Gee, Heon Yung; Oskouian, Babak; Srinivas, Honnappa; Choi, Won-Il; Shril, Shirlee; Ashraf, Shazia; Tan, Weizhen; Rao, Jia; Airik, Merlin; Schapiro, David; Braun, Daniela A; Sadowski, Carolin E; Widmeier, Eugen; Jobst-Schwan, Tilman; Schmidt, Johanna Magdalena; Girik, Vladimir; Capitani, Guido; Suh, Jung H; Lachaussée, Noëlle; Arrondel, Christelle; Patat, Julie; Gribouval, Olivier; Furlano, Monica; Boyer, Olivia; Schmitt, Alain; Vuiblet, Vincent; Hashmi, Seema; Wilcken, Rainer; Bernier, Francois P; Innes, A Micheil; Parboosingh, Jillian S; Lamont, Ryan E; Midgley, Julian P; Wright, Nicola; Majewski, Jacek; Zenker, Martin; Schaefer, Franz; Kuss, Navina; Greil, Johann; Giese, Thomas; Schwarz, Klaus; Catheline, Vilain; Schanze, Denny; Franke, Ingolf; Sznajer, Yves; Truant, Anne S; Adams, Brigitte; Désir, Julie; Biemann, Ronald; Pei, York; Ars, Elisabet; Lloberas, Nuria; Madrid, Alvaro; Dharnidharka, Vikas R; Connolly, Anne M; Willing, Marcia C; Cooper, Megan A; Lifton, Richard P; Simons, Matias; Riezman, Howard; Antignac, Corinne; Saba, Julie D; Hildebrandt, Friedhelm. Mutations in sphingosine-1-phosphate lyase cause nephrosis with ichthyosis and adrenal insufficiency. The Journal Of Clinical Investigation. 2017;127(3):912-928. PubMed |
Jung, Jinsei; Lin, Haiyue; Koh, Young Ik; Ryu, Kunhi; Lee, Joon Suk; Rim, John Hoon; Choi, Hye Ji; Lee, Hak Joon; Kim, Hye-Youn; Yu, Seyoung; Jin, Hyunsoo; Lee, Ji Hyun; Lee, Min Goo; Namkung, Wan; Choi, Jae Young; Gee, Heon Yung. Rare KCNQ4 variants found in public databases underlie impaired channel activity that may contribute to hearing impairment. Experimental & Molecular Medicine. 2019;51(8):1-12. PubMed |
Frisbie, Cole P; Lushnikov, Alexander Y; Krasnoslobodtsev, Alexey V; Riethoven, Jean-Jack M; Clarke, Jennifer L; Stepchenkova, Elena I; Petrosyan, Armen. Post-ER Stress Biogenesis of Golgi Is Governed by Giantin. Cells. 2019;8(12) PubMed |
Lei, Xiaobo; Dong, Xiaojing; Ma, Ruiyi; Wang, Wenjing; Xiao, Xia; Tian, Zhongqin; Wang, Conghui; Wang, Ying; Li, Li; Ren, Lili; Guo, Fei; Zhao, Zhendong; Zhou, Zhuo; Xiang, Zichun; Wang, Jianwei. Activation and evasion of type I interferon responses by SARS-CoV-2. Nature Communications. 2020;11(1):3810. PubMed |
Goldfarb, Adam N; Freeman, Katie C; Sahu, Ranjit K; Elagib, Kamaleldin E; Holy, Maja; Arneja, Abhinav; Polanowska-Grabowska, Renata; Gru, Alejandro A; White, Zollie 3rd; Khalil, Shadi; Kerins, Michael J; Ooi, Aikseng; Leitinger, Norbert; Luckey, Chance John; Delehanty, Lorrie L. Iron control of erythroid microtubule cytoskeleton as a potential target in treatment of iron-restricted anemia. Nature Communications. 2021;12(1):1645. PubMed |