Anti GOLGA6A pAb (ATL-HPA044978)

Atlas Antibodies

Catalog No.:
ATL-HPA044978-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: golgin A6 family, member A
Gene Name: GOLGA6A
Alternative Gene Name: GLP, GOLGA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020827: 35%, ENSRNOG00000056462: 35%
Entrez Gene ID: 342096
Uniprot ID: Q9NYA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
Gene Sequence GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
Gene ID - Mouse ENSMUSG00000020827
Gene ID - Rat ENSRNOG00000056462
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GOLGA6A pAb (ATL-HPA044978)
Datasheet Anti GOLGA6A pAb (ATL-HPA044978) Datasheet (External Link)
Vendor Page Anti GOLGA6A pAb (ATL-HPA044978) at Atlas Antibodies

Documents & Links for Anti GOLGA6A pAb (ATL-HPA044978)
Datasheet Anti GOLGA6A pAb (ATL-HPA044978) Datasheet (External Link)
Vendor Page Anti GOLGA6A pAb (ATL-HPA044978)