Anti GOLGA6A pAb (ATL-HPA044978)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044978-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GOLGA6A
Alternative Gene Name: GLP, GOLGA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020827: 35%, ENSRNOG00000056462: 35%
Entrez Gene ID: 342096
Uniprot ID: Q9NYA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA |
Gene Sequence | GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA |
Gene ID - Mouse | ENSMUSG00000020827 |
Gene ID - Rat | ENSRNOG00000056462 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GOLGA6A pAb (ATL-HPA044978) | |
Datasheet | Anti GOLGA6A pAb (ATL-HPA044978) Datasheet (External Link) |
Vendor Page | Anti GOLGA6A pAb (ATL-HPA044978) at Atlas Antibodies |
Documents & Links for Anti GOLGA6A pAb (ATL-HPA044978) | |
Datasheet | Anti GOLGA6A pAb (ATL-HPA044978) Datasheet (External Link) |
Vendor Page | Anti GOLGA6A pAb (ATL-HPA044978) |