Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000992-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: golgin A5
Gene Name: GOLGA5
Alternative Gene Name: golgin-84, GOLIM5, ret-II, rfg5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021192: 70%, ENSRNOG00000007699: 76%
Entrez Gene ID: 9950
Uniprot ID: Q8TBA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Gene Sequence SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Gene ID - Mouse ENSMUSG00000021192
Gene ID - Rat ENSRNOG00000007699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation)
Datasheet Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation)
Datasheet Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation)
Citations for Anti GOLGA5 pAb (ATL-HPA000992 w/enhanced validation) – 9 Found
Wong, Mie; Gillingham, Alison K; Munro, Sean. The golgin coiled-coil proteins capture different types of transport carriers via distinct N-terminal motifs. Bmc Biology. 2017;15(1):3.  PubMed
Gillingham, Alison K; Bertram, Jessie; Begum, Farida; Munro, Sean. In vivo identification of GTPase interactors by mitochondrial relocalization and proximity biotinylation. Elife. 2019;8( 31294692)  PubMed
Terasawa, Kazue; Kato, Yuji; Ikami, Yuta; Sakamoto, Kensaku; Ohtake, Kazumasa; Kusano, Seisuke; Tomabechi, Yuri; Kukimoto-Niino, Mutsuko; Shirouzu, Mikako; Guan, Jun-Lin; Kobayashi, Toshihide; Iwata, Takanori; Watabe, Tetsuro; Yokoyama, Shigeyuki; Hara-Yokoyama, Miki. Direct homophilic interaction of LAMP2A with the two-domain architecture revealed by site-directed photo-crosslinks and steric hindrances in mammalian cells. Autophagy. 2021;17(12):4286-4304.  PubMed
Mulder, J; Wernérus, H; Shi, T-J; Pontén, F; Hober, S; Uhlén, M; Hökfelt, T. Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system. Neuroscience. 2007;146(4):1689-703.  PubMed
Hsu, Ya-Chu; Jensen, Abbie M. Multiple domains in the Crumbs Homolog 2a (Crb2a) protein are required for regulating rod photoreceptor size. Bmc Cell Biology. 2010;11( 20670434):60.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed
Wong, Mie; Munro, Sean. Membrane trafficking. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science (New York, N.y.). 2014;346(6209):1256898.  PubMed
McGee, Lynessa J; Jiang, Alex L; Lan, Yu. Golga5 is dispensable for mouse embryonic development and postnatal survival. Genesis (New York, N.y. : 2000). 2017;55(7)  PubMed
Imberechts, Dorien; Kinnart, Inge; Wauters, Fieke; Terbeek, Joanne; Manders, Liselot; Wierda, Keimpe; Eggermont, Kristel; Madeiro, Rodrigo Furtado; Sue, Carolyn; Verfaillie, Catherine; Vandenberghe, Wim. DJ-1 is an essential downstream mediator in PINK1/parkin-dependent mitophagy. Brain : A Journal Of Neurology. 2022;145(12):4368-4384.  PubMed