Anti GOLGA4 pAb (ATL-HPA035102)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035102-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GOLGA4
Alternative Gene Name: GCP2, GOLG, golgin-240, p230
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038708: 72%, ENSRNOG00000029910: 63%
Entrez Gene ID: 2803
Uniprot ID: Q13439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE |
| Gene Sequence | NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE |
| Gene ID - Mouse | ENSMUSG00000038708 |
| Gene ID - Rat | ENSRNOG00000029910 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GOLGA4 pAb (ATL-HPA035102) | |
| Datasheet | Anti GOLGA4 pAb (ATL-HPA035102) Datasheet (External Link) |
| Vendor Page | Anti GOLGA4 pAb (ATL-HPA035102) at Atlas Antibodies |
| Documents & Links for Anti GOLGA4 pAb (ATL-HPA035102) | |
| Datasheet | Anti GOLGA4 pAb (ATL-HPA035102) Datasheet (External Link) |
| Vendor Page | Anti GOLGA4 pAb (ATL-HPA035102) |