Anti GOLGA4 pAb (ATL-HPA035102)

Atlas Antibodies

Catalog No.: ATL-HPA035102-25

Protein Description: golgin A4
Gene Name: GOLGA4
Alternative Gene Name: GCP2, GOLG, golgin-240, p230
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038708: 72%, ENSRNOG00000029910: 63%
Entrez Gene ID: 2803
Uniprot ID: Q13439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE
• Gene Sequence: NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE
• Gene ID - Mouse: ENSMUSG00000038708
• Gene ID - Rat: ENSRNOG00000029910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.