Anti GOLGA3 pAb (ATL-HPA040044 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040044-25
  • Immunohistochemical staining of human colon, prostate, testis and tonsil using Anti-GOLGA3 antibody HPA040044 (A) shows similar protein distribution across tissues to independent antibody HPA039809 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: golgin A3
Gene Name: GOLGA3
Alternative Gene Name: GCP170, golgin-160, MEA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029502: 90%, ENSRNOG00000061046: 91%
Entrez Gene ID: 2802
Uniprot ID: Q08378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Gene Sequence TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Gene ID - Mouse ENSMUSG00000029502
Gene ID - Rat ENSRNOG00000061046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GOLGA3 pAb (ATL-HPA040044 w/enhanced validation)
Datasheet Anti GOLGA3 pAb (ATL-HPA040044 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GOLGA3 pAb (ATL-HPA040044 w/enhanced validation)



Citations for Anti GOLGA3 pAb (ATL-HPA040044 w/enhanced validation) – 1 Found
Bhatt, Jay M; Hancock, William; Meissner, Justyna M; Kaczmarczyk, Aneta; Lee, Eunjoo; Viktorova, Ekaterina; Ramanadham, Sasanka; Belov, George A; Sztul, Elizabeth. Promiscuity of the catalytic Sec7 domain within the guanine nucleotide exchange factor GBF1 in ARF activation, Golgi homeostasis, and effector recruitment. Molecular Biology Of The Cell. 2019;30(12):1523-1535.  PubMed