Anti GOLGA2 pAb (ATL-HPA021178 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021178-25

• 
• 
• 

Protein Description: golgin A2
Gene Name: GOLGA2
Alternative Gene Name: GM130, golgin-95
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002546: 78%, ENSRNOG00000011884: 79%
Entrez Gene ID: 2801
Uniprot ID: Q08379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
• Gene Sequence: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
• Gene ID - Mouse: ENSMUSG00000002546
• Gene ID - Rat: ENSRNOG00000011884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.