Anti GNRH1 pAb (ATL-HPA027532)

Atlas Antibodies

Catalog No.: ATL-HPA027532-25

Protein Description: gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
Gene Name: GNRH1
Alternative Gene Name: GNRH, GRH, LHRH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015812: 75%, ENSRNOG00000013441: 75%
Entrez Gene ID: 2796
Uniprot ID: P01148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
• Gene Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
• Gene ID - Mouse: ENSMUSG00000015812
• Gene ID - Rat: ENSRNOG00000013441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GNRH1 pAb (ATL-HPA027532) – 1 Found

Acharya, Kalpana D; Nettles, Sabin A; Lichti, Cheryl F; Warre-Cornish, Katherine; Dutan Polit, Lucia; Srivastava, Deepak P; Denner, Larry; Tetel, Marc J. Dopamine-induced interactions of female mouse hypothalamic proteins with progestin receptor-A in the absence of hormone. Journal Of Neuroendocrinology. 2020;32(10):e12904.