Anti GNRH1 pAb (ATL-HPA027532)
Atlas Antibodies
- SKU:
- ATL-HPA027532-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GNRH1
Alternative Gene Name: GNRH, GRH, LHRH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015812: 75%, ENSRNOG00000013441: 75%
Entrez Gene ID: 2796
Uniprot ID: P01148
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
| Gene Sequence | QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
| Gene ID - Mouse | ENSMUSG00000015812 |
| Gene ID - Rat | ENSRNOG00000013441 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNRH1 pAb (ATL-HPA027532) | |
| Datasheet | Anti GNRH1 pAb (ATL-HPA027532) Datasheet (External Link) |
| Vendor Page | Anti GNRH1 pAb (ATL-HPA027532) at Atlas Antibodies |
| Documents & Links for Anti GNRH1 pAb (ATL-HPA027532) | |
| Datasheet | Anti GNRH1 pAb (ATL-HPA027532) Datasheet (External Link) |
| Vendor Page | Anti GNRH1 pAb (ATL-HPA027532) |
| Citations for Anti GNRH1 pAb (ATL-HPA027532) – 1 Found |
| Acharya, Kalpana D; Nettles, Sabin A; Lichti, Cheryl F; Warre-Cornish, Katherine; Dutan Polit, Lucia; Srivastava, Deepak P; Denner, Larry; Tetel, Marc J. Dopamine-induced interactions of female mouse hypothalamic proteins with progestin receptor-A in the absence of hormone. Journal Of Neuroendocrinology. 2020;32(10):e12904. PubMed |