Anti GNPNAT1 pAb (ATL-HPA044647)

Atlas Antibodies

SKU:
ATL-HPA044647-100
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glucosamine-phosphate N-acetyltransferase 1
Gene Name: GNPNAT1
Alternative Gene Name: FLJ10607, Gpnat1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037722: 98%, ENSRNOG00000008641: 98%
Entrez Gene ID: 64841
Uniprot ID: Q96EK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRR
Gene Sequence TPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRR
Gene ID - Mouse ENSMUSG00000037722
Gene ID - Rat ENSRNOG00000008641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNPNAT1 pAb (ATL-HPA044647)
Datasheet Anti GNPNAT1 pAb (ATL-HPA044647) Datasheet (External Link)
Vendor Page Anti GNPNAT1 pAb (ATL-HPA044647) at Atlas Antibodies

Documents & Links for Anti GNPNAT1 pAb (ATL-HPA044647)
Datasheet Anti GNPNAT1 pAb (ATL-HPA044647) Datasheet (External Link)
Vendor Page Anti GNPNAT1 pAb (ATL-HPA044647)



Citations for Anti GNPNAT1 pAb (ATL-HPA044647) – 2 Found
Clotet, Sergi; Soler, Maria Jose; Riera, Marta; Pascual, Julio; Fang, Fei; Zhou, Joyce; Batruch, Ihor; Vasiliou, Stella K; Dimitromanolakis, Apostolos; Barrios, Clara; Diamandis, Eleftherios P; Scholey, James W; Konvalinka, Ana. Stable Isotope Labeling with Amino Acids (SILAC)-Based Proteomics of Primary Human Kidney Cells Reveals a Novel Link between Male Sex Hormones and Impaired Energy Metabolism in Diabetic Kidney Disease. Molecular & Cellular Proteomics : Mcp. 2017;16(3):368-385.  PubMed
Tran, Diem Hong; May, Herman I; Li, Qinfeng; Luo, Xiang; Huang, Jian; Zhang, Guangyu; Niewold, Erica; Wang, Xiaoding; Gillette, Thomas G; Deng, Yingfeng; Wang, Zhao V. Chronic activation of hexosamine biosynthesis in the heart triggers pathological cardiac remodeling. Nature Communications. 2020;11(1):1771.  PubMed