Anti GNPNAT1 pAb (ATL-HPA044647)
Atlas Antibodies
- SKU:
- ATL-HPA044647-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GNPNAT1
Alternative Gene Name: FLJ10607, Gpnat1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037722: 98%, ENSRNOG00000008641: 98%
Entrez Gene ID: 64841
Uniprot ID: Q96EK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRR |
Gene Sequence | TPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRR |
Gene ID - Mouse | ENSMUSG00000037722 |
Gene ID - Rat | ENSRNOG00000008641 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GNPNAT1 pAb (ATL-HPA044647) | |
Datasheet | Anti GNPNAT1 pAb (ATL-HPA044647) Datasheet (External Link) |
Vendor Page | Anti GNPNAT1 pAb (ATL-HPA044647) at Atlas Antibodies |
Documents & Links for Anti GNPNAT1 pAb (ATL-HPA044647) | |
Datasheet | Anti GNPNAT1 pAb (ATL-HPA044647) Datasheet (External Link) |
Vendor Page | Anti GNPNAT1 pAb (ATL-HPA044647) |
Citations for Anti GNPNAT1 pAb (ATL-HPA044647) – 2 Found |
Clotet, Sergi; Soler, Maria Jose; Riera, Marta; Pascual, Julio; Fang, Fei; Zhou, Joyce; Batruch, Ihor; Vasiliou, Stella K; Dimitromanolakis, Apostolos; Barrios, Clara; Diamandis, Eleftherios P; Scholey, James W; Konvalinka, Ana. Stable Isotope Labeling with Amino Acids (SILAC)-Based Proteomics of Primary Human Kidney Cells Reveals a Novel Link between Male Sex Hormones and Impaired Energy Metabolism in Diabetic Kidney Disease. Molecular & Cellular Proteomics : Mcp. 2017;16(3):368-385. PubMed |
Tran, Diem Hong; May, Herman I; Li, Qinfeng; Luo, Xiang; Huang, Jian; Zhang, Guangyu; Niewold, Erica; Wang, Xiaoding; Gillette, Thomas G; Deng, Yingfeng; Wang, Zhao V. Chronic activation of hexosamine biosynthesis in the heart triggers pathological cardiac remodeling. Nature Communications. 2020;11(1):1771. PubMed |