Anti GNPDA1 pAb (ATL-HPA000499)

Atlas Antibodies

SKU:
ATL-HPA000499-100
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in germ cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glucosamine-6-phosphate deaminase 1
Gene Name: GNPDA1
Alternative Gene Name: GNPDA, GNPI, GPI, HLN, KIAA0060
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052102: 96%, ENSRNOG00000002177: 83%
Entrez Gene ID: 10007
Uniprot ID: P46926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAA
Gene Sequence EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAA
Gene ID - Mouse ENSMUSG00000052102
Gene ID - Rat ENSRNOG00000002177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNPDA1 pAb (ATL-HPA000499)
Datasheet Anti GNPDA1 pAb (ATL-HPA000499) Datasheet (External Link)
Vendor Page Anti GNPDA1 pAb (ATL-HPA000499) at Atlas Antibodies

Documents & Links for Anti GNPDA1 pAb (ATL-HPA000499)
Datasheet Anti GNPDA1 pAb (ATL-HPA000499) Datasheet (External Link)
Vendor Page Anti GNPDA1 pAb (ATL-HPA000499)



Citations for Anti GNPDA1 pAb (ATL-HPA000499) – 1 Found
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed