Anti GNMT pAb (ATL-HPA027501 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA027501-25
  • Immunohistochemistry analysis in human pancreas and colon tissues using Anti-GNMT antibody. Corresponding GNMT RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycine N-methyltransferase
Gene Name: GNMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002769: 88%, ENSRNOG00000048623: 90%
Entrez Gene ID: 27232
Uniprot ID: Q14749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY
Gene Sequence EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY
Gene ID - Mouse ENSMUSG00000002769
Gene ID - Rat ENSRNOG00000048623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNMT pAb (ATL-HPA027501 w/enhanced validation)
Datasheet Anti GNMT pAb (ATL-HPA027501 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNMT pAb (ATL-HPA027501 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNMT pAb (ATL-HPA027501 w/enhanced validation)
Datasheet Anti GNMT pAb (ATL-HPA027501 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNMT pAb (ATL-HPA027501 w/enhanced validation)



Citations for Anti GNMT pAb (ATL-HPA027501 w/enhanced validation) – 1 Found
Ottaviani, Silvia; Brooke, Greg N; O'Hanlon-Brown, Ciara; Waxman, Jonathan; Ali, Simak; Buluwela, Laki. Characterisation of the androgen regulation of glycine N-methyltransferase in prostate cancer cells. Journal Of Molecular Endocrinology. 2013;51(3):301-12.  PubMed