Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036315-25
  • Immunohistochemical staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
  • Western blot analysis using Anti-GNL3L antibody HPA036315 (A) shows similar pattern to independent antibody HPA036314 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein-like 3 (nucleolar)-like
Gene Name: GNL3L
Alternative Gene Name: FLJ10613
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025266: 79%, ENSRNOG00000002509: 79%
Entrez Gene ID: 54552
Uniprot ID: Q9NVN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELN
Gene Sequence QPAKQNGKKATSKVPSAPHFVHPNDHANREAELKKKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELN
Gene ID - Mouse ENSMUSG00000025266
Gene ID - Rat ENSRNOG00000002509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation)
Datasheet Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation)
Datasheet Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNL3L pAb (ATL-HPA036315 w/enhanced validation)