Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036742-25

Protein Description: guanine nucleotide binding protein-like 3 (nucleolar)
Gene Name: GNL3
Alternative Gene Name: C77032, E2IG3, MGC800, NS, nucleostemin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042354: 67%, ENSRNOG00000028461: 69%
Entrez Gene ID: 26354
Uniprot ID: Q9BVP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
• Gene Sequence: KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
• Gene ID - Mouse: ENSMUSG00000042354
• Gene ID - Rat: ENSRNOG00000028461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.