Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036742-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein-like 3 (nucleolar)
Gene Name: GNL3
Alternative Gene Name: C77032, E2IG3, MGC800, NS, nucleostemin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042354: 67%, ENSRNOG00000028461: 69%
Entrez Gene ID: 26354
Uniprot ID: Q9BVP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
Gene Sequence KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE
Gene ID - Mouse ENSMUSG00000042354
Gene ID - Rat ENSRNOG00000028461
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation)
Datasheet Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation)
Datasheet Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNL3 pAb (ATL-HPA036742 w/enhanced validation)