Anti GNL2 pAb (ATL-HPA027163)

Atlas Antibodies

SKU:
ATL-HPA027163-25
  • Immunohistochemical staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein-like 2 (nucleolar)
Gene Name: GNL2
Alternative Gene Name: HUMAUANTIG, Ngp-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028869: 68%, ENSRNOG00000009430: 68%
Entrez Gene ID: 29889
Uniprot ID: Q13823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVPQFSGDDLVPV
Gene Sequence RIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVPQFSGDDLVPV
Gene ID - Mouse ENSMUSG00000028869
Gene ID - Rat ENSRNOG00000009430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNL2 pAb (ATL-HPA027163)
Datasheet Anti GNL2 pAb (ATL-HPA027163) Datasheet (External Link)
Vendor Page Anti GNL2 pAb (ATL-HPA027163) at Atlas Antibodies

Documents & Links for Anti GNL2 pAb (ATL-HPA027163)
Datasheet Anti GNL2 pAb (ATL-HPA027163) Datasheet (External Link)
Vendor Page Anti GNL2 pAb (ATL-HPA027163)