Anti GNGT2 pAb (ATL-HPA043381)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043381-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GNGT2
Alternative Gene Name: GNG9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038811: 82%, ENSRNOG00000006108: 82%
Entrez Gene ID: 2793
Uniprot ID: O14610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP |
| Gene Sequence | EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP |
| Gene ID - Mouse | ENSMUSG00000038811 |
| Gene ID - Rat | ENSRNOG00000006108 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNGT2 pAb (ATL-HPA043381) | |
| Datasheet | Anti GNGT2 pAb (ATL-HPA043381) Datasheet (External Link) |
| Vendor Page | Anti GNGT2 pAb (ATL-HPA043381) at Atlas Antibodies |
| Documents & Links for Anti GNGT2 pAb (ATL-HPA043381) | |
| Datasheet | Anti GNGT2 pAb (ATL-HPA043381) Datasheet (External Link) |
| Vendor Page | Anti GNGT2 pAb (ATL-HPA043381) |