Anti GNGT2 pAb (ATL-HPA043381)

Atlas Antibodies

SKU: ATL-HPA043381-25

• 

Protein Description: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Gene Name: GNGT2
Alternative Gene Name: GNG9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038811: 82%, ENSRNOG00000006108: 82%
Entrez Gene ID: 2793
Uniprot ID: O14610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP
• Gene Sequence: EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP
• Gene ID - Mouse: ENSMUSG00000038811
• Gene ID - Rat: ENSRNOG00000006108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.