Anti GNGT2 pAb (ATL-HPA043381)

Atlas Antibodies

Catalog No.:
ATL-HPA043381-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Gene Name: GNGT2
Alternative Gene Name: GNG9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038811: 82%, ENSRNOG00000006108: 82%
Entrez Gene ID: 2793
Uniprot ID: O14610
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP
Gene Sequence EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP
Gene ID - Mouse ENSMUSG00000038811
Gene ID - Rat ENSRNOG00000006108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNGT2 pAb (ATL-HPA043381)
Datasheet Anti GNGT2 pAb (ATL-HPA043381) Datasheet (External Link)
Vendor Page Anti GNGT2 pAb (ATL-HPA043381) at Atlas Antibodies

Documents & Links for Anti GNGT2 pAb (ATL-HPA043381)
Datasheet Anti GNGT2 pAb (ATL-HPA043381) Datasheet (External Link)
Vendor Page Anti GNGT2 pAb (ATL-HPA043381)