Anti GNG5 pAb (ATL-HPA043651)

Atlas Antibodies

Catalog No.: ATL-HPA043651-100

Protein Description: guanine nucleotide binding protein (G protein), gamma 5
Gene Name: GNG5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068523: 100%, ENSRNOG00000039562: 100%
Entrez Gene ID: 2787
Uniprot ID: P63218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
• Gene Sequence: AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
• Gene ID - Mouse: ENSMUSG00000068523
• Gene ID - Rat: ENSRNOG00000039562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.