Anti GNG5 pAb (ATL-HPA043651)

Atlas Antibodies

Catalog No.:
ATL-HPA043651-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), gamma 5
Gene Name: GNG5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068523: 100%, ENSRNOG00000039562: 100%
Entrez Gene ID: 2787
Uniprot ID: P63218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
Gene Sequence AAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSF
Gene ID - Mouse ENSMUSG00000068523
Gene ID - Rat ENSRNOG00000039562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNG5 pAb (ATL-HPA043651)
Datasheet Anti GNG5 pAb (ATL-HPA043651) Datasheet (External Link)
Vendor Page Anti GNG5 pAb (ATL-HPA043651) at Atlas Antibodies

Documents & Links for Anti GNG5 pAb (ATL-HPA043651)
Datasheet Anti GNG5 pAb (ATL-HPA043651) Datasheet (External Link)
Vendor Page Anti GNG5 pAb (ATL-HPA043651)