Anti GNG13 pAb (ATL-HPA046272)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046272-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GNG13
Alternative Gene Name: G(gamma)13, h2-35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025739: 96%, ENSRNOG00000039350: 96%
Entrez Gene ID: 51764
Uniprot ID: Q9P2W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL |
| Gene Sequence | MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL |
| Gene ID - Mouse | ENSMUSG00000025739 |
| Gene ID - Rat | ENSRNOG00000039350 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNG13 pAb (ATL-HPA046272) | |
| Datasheet | Anti GNG13 pAb (ATL-HPA046272) Datasheet (External Link) |
| Vendor Page | Anti GNG13 pAb (ATL-HPA046272) at Atlas Antibodies |
| Documents & Links for Anti GNG13 pAb (ATL-HPA046272) | |
| Datasheet | Anti GNG13 pAb (ATL-HPA046272) Datasheet (External Link) |
| Vendor Page | Anti GNG13 pAb (ATL-HPA046272) |
| Citations for Anti GNG13 pAb (ATL-HPA046272) – 1 Found |
| AlMatrouk, Abdullah; Lemons, Kayla; Ogura, Tatsuya; Luo, Wangmei; Wilson, Chantel; Lin, Weihong. Chemical Exposure-Induced Changes in the Expression of Neurotrophins and Their Receptors in the Main Olfactory System of Mice Lacking TRPM5-Expressing Microvillous Cells. International Journal Of Molecular Sciences. 2018;19(10) PubMed |