Gene Name: GNE
Alternative Gene Name: IBM2, Uae1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028479: 100%, ENSRNOG00000014365: 100%
Entrez Gene ID: 10020
Uniprot ID: Q9Y223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLRVA |
| Gene Sequence | VPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLRVA |
| Gene ID - Mouse | ENSMUSG00000028479 |
| Gene ID - Rat | ENSRNOG00000014365 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNE pAb (ATL-HPA027258) | |
| Datasheet | Anti GNE pAb (ATL-HPA027258) Datasheet (External Link) |
| Vendor Page | Anti GNE pAb (ATL-HPA027258) at Atlas Antibodies |
| Documents & Links for Anti GNE pAb (ATL-HPA027258) | |
| Datasheet | Anti GNE pAb (ATL-HPA027258) Datasheet (External Link) |
| Vendor Page | Anti GNE pAb (ATL-HPA027258) |