Anti GNB5 pAb (ATL-HPA044198)

Atlas Antibodies

Catalog No.:
ATL-HPA044198-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), beta 5
Gene Name: GNB5
Alternative Gene Name: GB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032192: 100%, ENSRNOG00000047799: 100%
Entrez Gene ID: 10681
Uniprot ID: O14775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT
Gene Sequence DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT
Gene ID - Mouse ENSMUSG00000032192
Gene ID - Rat ENSRNOG00000047799
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNB5 pAb (ATL-HPA044198)
Datasheet Anti GNB5 pAb (ATL-HPA044198) Datasheet (External Link)
Vendor Page Anti GNB5 pAb (ATL-HPA044198) at Atlas Antibodies

Documents & Links for Anti GNB5 pAb (ATL-HPA044198)
Datasheet Anti GNB5 pAb (ATL-HPA044198) Datasheet (External Link)
Vendor Page Anti GNB5 pAb (ATL-HPA044198)