Anti GNB5 pAb (ATL-HPA044198)

Atlas Antibodies

SKU: ATL-HPA044198-25

• 

Protein Description: guanine nucleotide binding protein (G protein), beta 5
Gene Name: GNB5
Alternative Gene Name: GB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032192: 100%, ENSRNOG00000047799: 100%
Entrez Gene ID: 10681
Uniprot ID: O14775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT
• Gene Sequence: DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT
• Gene ID - Mouse: ENSMUSG00000032192
• Gene ID - Rat: ENSRNOG00000047799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.