Anti GNB5 pAb (ATL-HPA044198)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044198-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GNB5
Alternative Gene Name: GB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032192: 100%, ENSRNOG00000047799: 100%
Entrez Gene ID: 10681
Uniprot ID: O14775
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT |
Gene Sequence | DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT |
Gene ID - Mouse | ENSMUSG00000032192 |
Gene ID - Rat | ENSRNOG00000047799 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GNB5 pAb (ATL-HPA044198) | |
Datasheet | Anti GNB5 pAb (ATL-HPA044198) Datasheet (External Link) |
Vendor Page | Anti GNB5 pAb (ATL-HPA044198) at Atlas Antibodies |
Documents & Links for Anti GNB5 pAb (ATL-HPA044198) | |
Datasheet | Anti GNB5 pAb (ATL-HPA044198) Datasheet (External Link) |
Vendor Page | Anti GNB5 pAb (ATL-HPA044198) |