Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003011-100
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA003011 antibody. Corresponding GNAZ RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GNAZ over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400764).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), alpha z polypeptide
Gene Name: GNAZ
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040009: 98%, ENSRNOG00000001313: 98%
Entrez Gene ID: 2781
Uniprot ID: P19086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIF
Gene Sequence YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIF
Gene ID - Mouse ENSMUSG00000040009
Gene ID - Rat ENSRNOG00000001313
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation)
Datasheet Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation)
Datasheet Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GNAZ pAb (ATL-HPA003011 w/enhanced validation)