Anti GNAS pAb (ATL-HPA028386)

Atlas Antibodies

Catalog No.:
ATL-HPA028386-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: GNAS complex locus
Gene Name: GNAS
Alternative Gene Name: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027523: 63%, ENSRNOG00000047374: 68%
Entrez Gene ID: 2778
Uniprot ID: Q5JWF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
Gene Sequence SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
Gene ID - Mouse ENSMUSG00000027523
Gene ID - Rat ENSRNOG00000047374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNAS pAb (ATL-HPA028386)
Datasheet Anti GNAS pAb (ATL-HPA028386) Datasheet (External Link)
Vendor Page Anti GNAS pAb (ATL-HPA028386) at Atlas Antibodies

Documents & Links for Anti GNAS pAb (ATL-HPA028386)
Datasheet Anti GNAS pAb (ATL-HPA028386) Datasheet (External Link)
Vendor Page Anti GNAS pAb (ATL-HPA028386)