Anti GNAS pAb (ATL-HPA028386)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028386-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: GNAS
Alternative Gene Name: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027523: 63%, ENSRNOG00000047374: 68%
Entrez Gene ID: 2778
Uniprot ID: Q5JWF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE |
Gene Sequence | SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE |
Gene ID - Mouse | ENSMUSG00000027523 |
Gene ID - Rat | ENSRNOG00000047374 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GNAS pAb (ATL-HPA028386) | |
Datasheet | Anti GNAS pAb (ATL-HPA028386) Datasheet (External Link) |
Vendor Page | Anti GNAS pAb (ATL-HPA028386) at Atlas Antibodies |
Documents & Links for Anti GNAS pAb (ATL-HPA028386) | |
Datasheet | Anti GNAS pAb (ATL-HPA028386) Datasheet (External Link) |
Vendor Page | Anti GNAS pAb (ATL-HPA028386) |