Anti GNAS pAb (ATL-HPA027478)

Atlas Antibodies

Catalog No.: ATL-HPA027478-100

Protein Description: GNAS complex locus
Gene Name: GNAS
Alternative Gene Name: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027523: 45%, ENSRNOG00000047374: 45%
Entrez Gene ID: 2778
Uniprot ID: Q5JWF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEK
• Gene Sequence: GDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEK
• Gene ID - Mouse: ENSMUSG00000027523
• Gene ID - Rat: ENSRNOG00000047374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.