Anti GNAS pAb (ATL-HPA027478)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027478-100
- Shipping:
- Calculated at Checkout
$520.00
Gene Name: GNAS
Alternative Gene Name: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027523: 45%, ENSRNOG00000047374: 45%
Entrez Gene ID: 2778
Uniprot ID: Q5JWF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEK |
| Gene Sequence | GDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEK |
| Gene ID - Mouse | ENSMUSG00000027523 |
| Gene ID - Rat | ENSRNOG00000047374 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNAS pAb (ATL-HPA027478) | |
| Datasheet | Anti GNAS pAb (ATL-HPA027478) Datasheet (External Link) |
| Vendor Page | Anti GNAS pAb (ATL-HPA027478) at Atlas Antibodies |
| Documents & Links for Anti GNAS pAb (ATL-HPA027478) | |
| Datasheet | Anti GNAS pAb (ATL-HPA027478) Datasheet (External Link) |
| Vendor Page | Anti GNAS pAb (ATL-HPA027478) |