Anti GNAL pAb (ATL-HPA051160)

Atlas Antibodies

Catalog No.:
ATL-HPA051160-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: G protein subunit alpha L
Gene Name: GNAL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024524: 100%, ENSRNOG00000010440: 100%
Entrez Gene ID: 2774
Uniprot ID: P38405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER
Gene Sequence NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER
Gene ID - Mouse ENSMUSG00000024524
Gene ID - Rat ENSRNOG00000010440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNAL pAb (ATL-HPA051160)
Datasheet Anti GNAL pAb (ATL-HPA051160) Datasheet (External Link)
Vendor Page Anti GNAL pAb (ATL-HPA051160) at Atlas Antibodies

Documents & Links for Anti GNAL pAb (ATL-HPA051160)
Datasheet Anti GNAL pAb (ATL-HPA051160) Datasheet (External Link)
Vendor Page Anti GNAL pAb (ATL-HPA051160)