Anti GNAL pAb (ATL-HPA051160)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051160-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GNAL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024524: 100%, ENSRNOG00000010440: 100%
Entrez Gene ID: 2774
Uniprot ID: P38405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER |
Gene Sequence | NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER |
Gene ID - Mouse | ENSMUSG00000024524 |
Gene ID - Rat | ENSRNOG00000010440 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GNAL pAb (ATL-HPA051160) | |
Datasheet | Anti GNAL pAb (ATL-HPA051160) Datasheet (External Link) |
Vendor Page | Anti GNAL pAb (ATL-HPA051160) at Atlas Antibodies |
Documents & Links for Anti GNAL pAb (ATL-HPA051160) | |
Datasheet | Anti GNAL pAb (ATL-HPA051160) Datasheet (External Link) |
Vendor Page | Anti GNAL pAb (ATL-HPA051160) |