Anti GNAI2 pAb (ATL-HPA007704)

Atlas Antibodies

SKU:
ATL-HPA007704-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
Gene Name: GNAI2
Alternative Gene Name: GIP, GNAI2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032562: 96%, ENSRNOG00000016592: 96%
Entrez Gene ID: 2771
Uniprot ID: P04899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLER
Gene Sequence EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLER
Gene ID - Mouse ENSMUSG00000032562
Gene ID - Rat ENSRNOG00000016592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GNAI2 pAb (ATL-HPA007704)
Datasheet Anti GNAI2 pAb (ATL-HPA007704) Datasheet (External Link)
Vendor Page Anti GNAI2 pAb (ATL-HPA007704) at Atlas Antibodies

Documents & Links for Anti GNAI2 pAb (ATL-HPA007704)
Datasheet Anti GNAI2 pAb (ATL-HPA007704) Datasheet (External Link)
Vendor Page Anti GNAI2 pAb (ATL-HPA007704)