Anti GNA13 pAb (ATL-HPA010087)

Atlas Antibodies

Catalog No.:
ATL-HPA010087-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: guanine nucleotide binding protein (G protein), alpha 13
Gene Name: GNA13
Alternative Gene Name: G13, MGC46138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020611: 95%, ENSRNOG00000036745: 95%
Entrez Gene ID: 10672
Uniprot ID: Q14344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES
Gene Sequence HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES
Gene ID - Mouse ENSMUSG00000020611
Gene ID - Rat ENSRNOG00000036745
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GNA13 pAb (ATL-HPA010087)
Datasheet Anti GNA13 pAb (ATL-HPA010087) Datasheet (External Link)
Vendor Page Anti GNA13 pAb (ATL-HPA010087) at Atlas Antibodies

Documents & Links for Anti GNA13 pAb (ATL-HPA010087)
Datasheet Anti GNA13 pAb (ATL-HPA010087) Datasheet (External Link)
Vendor Page Anti GNA13 pAb (ATL-HPA010087)
Citations for Anti GNA13 pAb (ATL-HPA010087) – 1 Found
Rasheed, Suhail Ahmed Kabeer; Leong, Hui Sun; Lakshmanan, Manikandan; Raju, Anandhkumar; Dadlani, Dhivya; Chong, Fui-Teen; Shannon, Nicholas B; Rajarethinam, Ravisankar; Skanthakumar, Thakshayeni; Tan, Ern Yu; Hwang, Jacqueline Siok Gek; Lim, Kok Hing; Tan, Daniel Shao-Weng; Ceppi, Paolo; Wang, Mei; Tergaonkar, Vinay; Casey, Patrick J; Iyer, N Gopalakrishna. GNA13 expression promotes drug resistance and tumor-initiating phenotypes in squamous cell cancers. Oncogene. 2018;37(10):1340-1353.  PubMed