Anti GNA13 pAb (ATL-HPA010087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010087-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GNA13
Alternative Gene Name: G13, MGC46138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020611: 95%, ENSRNOG00000036745: 95%
Entrez Gene ID: 10672
Uniprot ID: Q14344
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES |
| Gene Sequence | HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGES |
| Gene ID - Mouse | ENSMUSG00000020611 |
| Gene ID - Rat | ENSRNOG00000036745 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GNA13 pAb (ATL-HPA010087) | |
| Datasheet | Anti GNA13 pAb (ATL-HPA010087) Datasheet (External Link) |
| Vendor Page | Anti GNA13 pAb (ATL-HPA010087) at Atlas Antibodies |
| Documents & Links for Anti GNA13 pAb (ATL-HPA010087) | |
| Datasheet | Anti GNA13 pAb (ATL-HPA010087) Datasheet (External Link) |
| Vendor Page | Anti GNA13 pAb (ATL-HPA010087) |
| Citations for Anti GNA13 pAb (ATL-HPA010087) – 1 Found |
| Rasheed, Suhail Ahmed Kabeer; Leong, Hui Sun; Lakshmanan, Manikandan; Raju, Anandhkumar; Dadlani, Dhivya; Chong, Fui-Teen; Shannon, Nicholas B; Rajarethinam, Ravisankar; Skanthakumar, Thakshayeni; Tan, Ern Yu; Hwang, Jacqueline Siok Gek; Lim, Kok Hing; Tan, Daniel Shao-Weng; Ceppi, Paolo; Wang, Mei; Tergaonkar, Vinay; Casey, Patrick J; Iyer, N Gopalakrishna. GNA13 expression promotes drug resistance and tumor-initiating phenotypes in squamous cell cancers. Oncogene. 2018;37(10):1340-1353. PubMed |