Anti GMPS pAb (ATL-HPA046630)

Atlas Antibodies

Catalog No.:
ATL-HPA046630-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: guanine monophosphate synthase
Gene Name: GMPS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027823: 97%, ENSRNOG00000051151: 98%
Entrez Gene ID: 8833
Uniprot ID: P49915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT
Gene Sequence AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT
Gene ID - Mouse ENSMUSG00000027823
Gene ID - Rat ENSRNOG00000051151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GMPS pAb (ATL-HPA046630)
Datasheet Anti GMPS pAb (ATL-HPA046630) Datasheet (External Link)
Vendor Page Anti GMPS pAb (ATL-HPA046630) at Atlas Antibodies

Documents & Links for Anti GMPS pAb (ATL-HPA046630)
Datasheet Anti GMPS pAb (ATL-HPA046630) Datasheet (External Link)
Vendor Page Anti GMPS pAb (ATL-HPA046630)