Anti GMPPB pAb (ATL-HPA014657)

Atlas Antibodies

SKU: ATL-HPA014657-25

• 
• 

Protein Description: GDP-mannose pyrophosphorylase B
Gene Name: GMPPB
Alternative Gene Name: KIAA1851
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070284: 97%, ENSRNOG00000037229: 97%
Entrez Gene ID: 29925
Uniprot ID: Q9Y5P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMA
• Gene Sequence: VLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMA
• Gene ID - Mouse: ENSMUSG00000070284
• Gene ID - Rat: ENSRNOG00000037229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GMPPB pAb (ATL-HPA014657) – 1 Found

Tian, Wo-Tu; Zhou, Hai-Yan; Zhan, Fei-Xia; Zhu, Ze-Yu; Yang, Jie; Chen, Sheng-Di; Luan, Xing-Hua; Cao, Li. Lysosomal degradation of GMPPB is associated with limb-girdle muscular dystrophy type 2T. Annals Of Clinical And Translational Neurology. 2019;6(6):1062-1071.