Anti GMFB pAb (ATL-HPA002954)

Atlas Antibodies

SKU:
ATL-HPA002954-25
  • Immunofluorescence staining of mouse brain shows strong positivity in neurons and dendrites in cerebral cortex.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol.
  • Western blot analysis in human cell line A-431.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glia maturation factor, beta
Gene Name: GMFB
Alternative Gene Name: GMF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062014: 97%, ENSRNOG00000047250: 94%
Entrez Gene ID: 2764
Uniprot ID: P60983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Gene Sequence SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN
Gene ID - Mouse ENSMUSG00000062014
Gene ID - Rat ENSRNOG00000047250
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GMFB pAb (ATL-HPA002954)
Datasheet Anti GMFB pAb (ATL-HPA002954) Datasheet (External Link)
Vendor Page Anti GMFB pAb (ATL-HPA002954) at Atlas Antibodies

Documents & Links for Anti GMFB pAb (ATL-HPA002954)
Datasheet Anti GMFB pAb (ATL-HPA002954) Datasheet (External Link)
Vendor Page Anti GMFB pAb (ATL-HPA002954)



Citations for Anti GMFB pAb (ATL-HPA002954) – 2 Found
Yu, Yang; Wu, Jindao; Fan, Yong; Lv, Zhuo; Guo, Xuejiang; Zhao, Chun; Zhou, Rong; Zhang, Zhuo; Wang, Fuqiang; Xiao, Min; Chen, Ling; Zhu, Hui; Chen, Wen; Lin, Min; Liu, Jiayin; Zhou, Zuomin; Wang, Liu; Huo, Ran; Zhou, Qi; Sha, Jiahao. Evaluation of blastomere biopsy using a mouse model indicates the potential high risk of neurodegenerative disorders in the offspring. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1490-500.  PubMed
Haynes, Elizabeth M; Asokan, Sreeja B; King, Samantha J; Johnson, Heath E; Haugh, Jason M; Bear, James E. GMFβ controls branched actin content and lamellipodial retraction in fibroblasts. The Journal Of Cell Biology. 2015;209(6):803-12.  PubMed