Anti GMFB pAb (ATL-HPA002954)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002954-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GMFB
Alternative Gene Name: GMF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062014: 97%, ENSRNOG00000047250: 94%
Entrez Gene ID: 2764
Uniprot ID: P60983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN |
| Gene Sequence | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN |
| Gene ID - Mouse | ENSMUSG00000062014 |
| Gene ID - Rat | ENSRNOG00000047250 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GMFB pAb (ATL-HPA002954) | |
| Datasheet | Anti GMFB pAb (ATL-HPA002954) Datasheet (External Link) |
| Vendor Page | Anti GMFB pAb (ATL-HPA002954) at Atlas Antibodies |
| Documents & Links for Anti GMFB pAb (ATL-HPA002954) | |
| Datasheet | Anti GMFB pAb (ATL-HPA002954) Datasheet (External Link) |
| Vendor Page | Anti GMFB pAb (ATL-HPA002954) |
| Citations for Anti GMFB pAb (ATL-HPA002954) – 2 Found |
| Yu, Yang; Wu, Jindao; Fan, Yong; Lv, Zhuo; Guo, Xuejiang; Zhao, Chun; Zhou, Rong; Zhang, Zhuo; Wang, Fuqiang; Xiao, Min; Chen, Ling; Zhu, Hui; Chen, Wen; Lin, Min; Liu, Jiayin; Zhou, Zuomin; Wang, Liu; Huo, Ran; Zhou, Qi; Sha, Jiahao. Evaluation of blastomere biopsy using a mouse model indicates the potential high risk of neurodegenerative disorders in the offspring. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1490-500. PubMed |
| Haynes, Elizabeth M; Asokan, Sreeja B; King, Samantha J; Johnson, Heath E; Haugh, Jason M; Bear, James E. GMFβ controls branched actin content and lamellipodial retraction in fibroblasts. The Journal Of Cell Biology. 2015;209(6):803-12. PubMed |