Anti GMEB1 pAb (ATL-HPA044811 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044811-100

• 
• 
• 

Protein Description: glucocorticoid modulatory element binding protein 1
Gene Name: GMEB1
Alternative Gene Name: P96PIF, PIF96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028901: 99%, ENSRNOG00000010910: 98%
Entrez Gene ID: 10691
Uniprot ID: Q9Y692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSS
• Gene Sequence: NVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSS
• Gene ID - Mouse: ENSMUSG00000028901
• Gene ID - Rat: ENSRNOG00000010910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.