Anti GMCL1 pAb (ATL-HPA039579)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039579-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GMCL1
Alternative Gene Name: BTBD13, FLJ13057, GCL1, SPATA29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001157: 89%, ENSRNOG00000017838: 90%
Entrez Gene ID: 64395
Uniprot ID: Q96IK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQD |
Gene Sequence | WMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQD |
Gene ID - Mouse | ENSMUSG00000001157 |
Gene ID - Rat | ENSRNOG00000017838 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GMCL1 pAb (ATL-HPA039579) | |
Datasheet | Anti GMCL1 pAb (ATL-HPA039579) Datasheet (External Link) |
Vendor Page | Anti GMCL1 pAb (ATL-HPA039579) at Atlas Antibodies |
Documents & Links for Anti GMCL1 pAb (ATL-HPA039579) | |
Datasheet | Anti GMCL1 pAb (ATL-HPA039579) Datasheet (External Link) |
Vendor Page | Anti GMCL1 pAb (ATL-HPA039579) |