Anti GMCL1 pAb (ATL-HPA039579)

Atlas Antibodies

SKU:
ATL-HPA039579-25
  • Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: germ cell-less, spermatogenesis associated 1
Gene Name: GMCL1
Alternative Gene Name: BTBD13, FLJ13057, GCL1, SPATA29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001157: 89%, ENSRNOG00000017838: 90%
Entrez Gene ID: 64395
Uniprot ID: Q96IK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQD
Gene Sequence WMFLQLVPSWNGSLKQLLTETDVWFSKQRKDFEGMAFLETEQGKPFVSVFRHLRLQYIISDLASARIIEQDAVVPSEWLSSVYKQQWFAMLRAEQD
Gene ID - Mouse ENSMUSG00000001157
Gene ID - Rat ENSRNOG00000017838
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GMCL1 pAb (ATL-HPA039579)
Datasheet Anti GMCL1 pAb (ATL-HPA039579) Datasheet (External Link)
Vendor Page Anti GMCL1 pAb (ATL-HPA039579) at Atlas Antibodies

Documents & Links for Anti GMCL1 pAb (ATL-HPA039579)
Datasheet Anti GMCL1 pAb (ATL-HPA039579) Datasheet (External Link)
Vendor Page Anti GMCL1 pAb (ATL-HPA039579)