Anti GLYATL3 pAb (ATL-HPA044044)

Atlas Antibodies

Catalog No.:
ATL-HPA044044-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycine-N-acyltransferase-like 3
Gene Name: GLYATL3
Alternative Gene Name: bA28H17.2, C6orf140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091043: 93%, ENSRNOG00000050990: 94%
Entrez Gene ID: 389396
Uniprot ID: Q5SZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILT
Gene Sequence DQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILT
Gene ID - Mouse ENSMUSG00000091043
Gene ID - Rat ENSRNOG00000050990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLYATL3 pAb (ATL-HPA044044)
Datasheet Anti GLYATL3 pAb (ATL-HPA044044) Datasheet (External Link)
Vendor Page Anti GLYATL3 pAb (ATL-HPA044044) at Atlas Antibodies

Documents & Links for Anti GLYATL3 pAb (ATL-HPA044044)
Datasheet Anti GLYATL3 pAb (ATL-HPA044044) Datasheet (External Link)
Vendor Page Anti GLYATL3 pAb (ATL-HPA044044)