Anti GLYATL1 pAb (ATL-HPA039501)

Atlas Antibodies

Catalog No.:
ATL-HPA039501-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycine-N-acyltransferase-like 1
Gene Name: GLYATL1
Alternative Gene Name: FLJ34646, MGC15397
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034617: 27%, ENSRNOG00000017826: 28%
Entrez Gene ID: 92292
Uniprot ID: Q969I3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGHPDDEFESETPNFKYAQ
Gene Sequence QGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGHPDDEFESETPNFKYAQ
Gene ID - Mouse ENSMUSG00000034617
Gene ID - Rat ENSRNOG00000017826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLYATL1 pAb (ATL-HPA039501)
Datasheet Anti GLYATL1 pAb (ATL-HPA039501) Datasheet (External Link)
Vendor Page Anti GLYATL1 pAb (ATL-HPA039501) at Atlas Antibodies

Documents & Links for Anti GLYATL1 pAb (ATL-HPA039501)
Datasheet Anti GLYATL1 pAb (ATL-HPA039501) Datasheet (External Link)
Vendor Page Anti GLYATL1 pAb (ATL-HPA039501)