Anti GLUL pAb (ATL-HPA007316 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007316-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GLUL
Alternative Gene Name: GLNS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026473: 95%, ENSRNOG00000049560: 92%
Entrez Gene ID: 2752
Uniprot ID: P15104
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP |
| Gene Sequence | LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP |
| Gene ID - Mouse | ENSMUSG00000026473 |
| Gene ID - Rat | ENSRNOG00000049560 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) | |
| Datasheet | Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) | |
| Datasheet | Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) |
| Citations for Anti GLUL pAb (ATL-HPA007316 w/enhanced validation) – 5 Found |
| Kitajima, Shojiro; Lee, Kian Leong; Hikasa, Hiroki; Sun, Wendi; Huang, Ruby Yun-Ju; Yang, Henry; Matsunaga, Shinji; Yamaguchi, Takehiro; Araki, Marito; Kato, Hiroyuki; Poellinger, Lorenz. Hypoxia-inducible factor-1α promotes cell survival during ammonia stress response in ovarian cancer stem-like cells. Oncotarget. 2017;8(70):114481-114494. PubMed |
| Ko, Ying-Hui; Lin, Zhao; Flomenberg, Neal; Pestell, Richard G; Howell, Anthony; Sotgia, Federica; Lisanti, Michael P; Martinez-Outschoorn, Ubaldo E. Glutamine fuels a vicious cycle of autophagy in the tumor stroma and oxidative mitochondrial metabolism in epithelial cancer cells: implications for preventing chemotherapy resistance. Cancer Biology & Therapy. 2011;12(12):1085-97. PubMed |
| Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43. PubMed |
| Guo, Jing; Satoh, Kiyotoshi; Tabata, Sho; Mori, Masaru; Tomita, Masaru; Soga, Tomoyoshi. Reprogramming of glutamine metabolism via glutamine synthetase silencing induces cisplatin resistance in A2780 ovarian cancer cells. Bmc Cancer. 2021;21(1):174. PubMed |
| Villar, Victor H; Allega, Maria Francesca; Deshmukh, Ruhi; Ackermann, Tobias; Nakasone, Mark A; Vande Voorde, Johan; Drake, Thomas M; Oetjen, Janina; Bloom, Algernon; Nixon, Colin; Müller, Miryam; May, Stephanie; Tan, Ee Hong; Vereecke, Lars; Jans, Maude; Blancke, Gillian; Murphy, Daniel J; Huang, Danny T; Lewis, David Y; Bird, Thomas G; Sansom, Owen J; Blyth, Karen; Sumpton, David; Tardito, Saverio. Hepatic glutamine synthetase controls N(5)-methylglutamine in homeostasis and cancer. Nature Chemical Biology. 2023;19(3):292-300. PubMed |