Anti GLUD1 pAb (ATL-HPA042492)
Atlas Antibodies
- SKU:
- ATL-HPA042492-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GLUD1
Alternative Gene Name: GDH, GLUD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021794: 100%, ENSRNOG00000057367: 100%
Entrez Gene ID: 2746
Uniprot ID: P00367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN |
Gene Sequence | KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN |
Gene ID - Mouse | ENSMUSG00000021794 |
Gene ID - Rat | ENSRNOG00000057367 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLUD1 pAb (ATL-HPA042492) | |
Datasheet | Anti GLUD1 pAb (ATL-HPA042492) Datasheet (External Link) |
Vendor Page | Anti GLUD1 pAb (ATL-HPA042492) at Atlas Antibodies |
Documents & Links for Anti GLUD1 pAb (ATL-HPA042492) | |
Datasheet | Anti GLUD1 pAb (ATL-HPA042492) Datasheet (External Link) |
Vendor Page | Anti GLUD1 pAb (ATL-HPA042492) |