Anti GLT8D2 pAb (ATL-HPA026904 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026904-25
  • Immunohistochemical staining of human liver shows strong membranous and cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line RH-30 shows localization to cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GLT8D2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410552).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycosyltransferase 8 domain containing 2
Gene Name: GLT8D2
Alternative Gene Name: FLJ31494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020251: 99%, ENSRNOG00000033579: 98%
Entrez Gene ID: 83468
Uniprot ID: Q9H1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDARYSEHFLQEAKLLH
Gene Sequence MGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDARYSEHFLQEAKLLH
Gene ID - Mouse ENSMUSG00000020251
Gene ID - Rat ENSRNOG00000033579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GLT8D2 pAb (ATL-HPA026904 w/enhanced validation)
Datasheet Anti GLT8D2 pAb (ATL-HPA026904 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLT8D2 pAb (ATL-HPA026904 w/enhanced validation)