Anti GLT8D2 pAb (ATL-HPA012740)

Atlas Antibodies

Catalog No.:
ATL-HPA012740-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycosyltransferase 8 domain containing 2
Gene Name: GLT8D2
Alternative Gene Name: FLJ31494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020251: 99%, ENSRNOG00000033579: 98%
Entrez Gene ID: 83468
Uniprot ID: Q9H1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDARYSEHFLQEAKLLH
Gene Sequence MGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDARYSEHFLQEAKLLH
Gene ID - Mouse ENSMUSG00000020251
Gene ID - Rat ENSRNOG00000033579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLT8D2 pAb (ATL-HPA012740)
Datasheet Anti GLT8D2 pAb (ATL-HPA012740) Datasheet (External Link)
Vendor Page Anti GLT8D2 pAb (ATL-HPA012740) at Atlas Antibodies

Documents & Links for Anti GLT8D2 pAb (ATL-HPA012740)
Datasheet Anti GLT8D2 pAb (ATL-HPA012740) Datasheet (External Link)
Vendor Page Anti GLT8D2 pAb (ATL-HPA012740)