Anti GLT8D1 pAb (ATL-HPA010588)

Atlas Antibodies

SKU: ATL-HPA010588-25

• 
• 

Protein Description: glycosyltransferase 8 domain containing 1
Gene Name: GLT8D1
Alternative Gene Name: AD-017, FLJ14611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021916: 87%, ENSRNOG00000018179: 88%
Entrez Gene ID: 55830
Uniprot ID: Q68CQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG
• Gene Sequence: VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG
• Gene ID - Mouse: ENSMUSG00000021916
• Gene ID - Rat: ENSRNOG00000018179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.