Anti GLT8D1 pAb (ATL-HPA010588)

Atlas Antibodies

Catalog No.:
ATL-HPA010588-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycosyltransferase 8 domain containing 1
Gene Name: GLT8D1
Alternative Gene Name: AD-017, FLJ14611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021916: 87%, ENSRNOG00000018179: 88%
Entrez Gene ID: 55830
Uniprot ID: Q68CQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG
Gene Sequence VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG
Gene ID - Mouse ENSMUSG00000021916
Gene ID - Rat ENSRNOG00000018179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLT8D1 pAb (ATL-HPA010588)
Datasheet Anti GLT8D1 pAb (ATL-HPA010588) Datasheet (External Link)
Vendor Page Anti GLT8D1 pAb (ATL-HPA010588) at Atlas Antibodies

Documents & Links for Anti GLT8D1 pAb (ATL-HPA010588)
Datasheet Anti GLT8D1 pAb (ATL-HPA010588) Datasheet (External Link)
Vendor Page Anti GLT8D1 pAb (ATL-HPA010588)