Anti GLT8D1 pAb (ATL-HPA010588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010588-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GLT8D1
Alternative Gene Name: AD-017, FLJ14611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021916: 87%, ENSRNOG00000018179: 88%
Entrez Gene ID: 55830
Uniprot ID: Q68CQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG |
| Gene Sequence | VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG |
| Gene ID - Mouse | ENSMUSG00000021916 |
| Gene ID - Rat | ENSRNOG00000018179 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLT8D1 pAb (ATL-HPA010588) | |
| Datasheet | Anti GLT8D1 pAb (ATL-HPA010588) Datasheet (External Link) |
| Vendor Page | Anti GLT8D1 pAb (ATL-HPA010588) at Atlas Antibodies |
| Documents & Links for Anti GLT8D1 pAb (ATL-HPA010588) | |
| Datasheet | Anti GLT8D1 pAb (ATL-HPA010588) Datasheet (External Link) |
| Vendor Page | Anti GLT8D1 pAb (ATL-HPA010588) |