Anti GLT6D1 pAb (ATL-HPA023424)
Atlas Antibodies
- SKU:
- ATL-HPA023424-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GLT6D1
Alternative Gene Name: GLTDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036401: 61%, ENSRNOG00000027900: 67%
Entrez Gene ID: 360203
Uniprot ID: Q7Z4J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYE |
Gene Sequence | PLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYE |
Gene ID - Mouse | ENSMUSG00000036401 |
Gene ID - Rat | ENSRNOG00000027900 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLT6D1 pAb (ATL-HPA023424) | |
Datasheet | Anti GLT6D1 pAb (ATL-HPA023424) Datasheet (External Link) |
Vendor Page | Anti GLT6D1 pAb (ATL-HPA023424) at Atlas Antibodies |
Documents & Links for Anti GLT6D1 pAb (ATL-HPA023424) | |
Datasheet | Anti GLT6D1 pAb (ATL-HPA023424) Datasheet (External Link) |
Vendor Page | Anti GLT6D1 pAb (ATL-HPA023424) |