Anti GLT6D1 pAb (ATL-HPA023424)

Atlas Antibodies

SKU:
ATL-HPA023424-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycosyltransferase 6 domain containing 1
Gene Name: GLT6D1
Alternative Gene Name: GLTDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036401: 61%, ENSRNOG00000027900: 67%
Entrez Gene ID: 360203
Uniprot ID: Q7Z4J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYE
Gene Sequence PLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGLNSTYE
Gene ID - Mouse ENSMUSG00000036401
Gene ID - Rat ENSRNOG00000027900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLT6D1 pAb (ATL-HPA023424)
Datasheet Anti GLT6D1 pAb (ATL-HPA023424) Datasheet (External Link)
Vendor Page Anti GLT6D1 pAb (ATL-HPA023424) at Atlas Antibodies

Documents & Links for Anti GLT6D1 pAb (ATL-HPA023424)
Datasheet Anti GLT6D1 pAb (ATL-HPA023424) Datasheet (External Link)
Vendor Page Anti GLT6D1 pAb (ATL-HPA023424)