Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042465-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GLRX5
Alternative Gene Name: C14orf87, GRX5, PR01238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021102: 100%, ENSRNOG00000004206: 99%
Entrez Gene ID: 51218
Uniprot ID: Q86SX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLV |
| Gene Sequence | LVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLV |
| Gene ID - Mouse | ENSMUSG00000021102 |
| Gene ID - Rat | ENSRNOG00000004206 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) | |
| Datasheet | Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) | |
| Datasheet | Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) |
| Citations for Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) – 2 Found |
| Kubota, Yoshiko; Nomura, Kazumi; Katoh, Yasutake; Yamashita, Rina; Kaneko, Kiriko; Furuyama, Kazumichi. Novel Mechanisms for Heme-dependent Degradation of ALAS1 Protein as a Component of Negative Feedback Regulation of Heme Biosynthesis. The Journal Of Biological Chemistry. 2016;291(39):20516-29. PubMed |
| Anderton, Brittany; Camarda, Roman; Balakrishnan, Sanjeev; Balakrishnan, Asha; Kohnz, Rebecca A; Lim, Lionel; Evason, Kimberley J; Momcilovic, Olga; Kruttwig, Klaus; Huang, Qiang; Xu, Guowang; Nomura, Daniel K; Goga, Andrei. MYC-driven inhibition of the glutamate-cysteine ligase promotes glutathione depletion in liver cancer. Embo Reports. 2017;18(4):569-585. PubMed |