Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042465-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glutaredoxin 5
Gene Name: GLRX5
Alternative Gene Name: C14orf87, GRX5, PR01238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021102: 100%, ENSRNOG00000004206: 99%
Entrez Gene ID: 51218
Uniprot ID: Q86SX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLV
Gene Sequence LVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLV
Gene ID - Mouse ENSMUSG00000021102
Gene ID - Rat ENSRNOG00000004206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation)
Datasheet Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation)
Datasheet Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation)
Citations for Anti GLRX5 pAb (ATL-HPA042465 w/enhanced validation) – 2 Found
Kubota, Yoshiko; Nomura, Kazumi; Katoh, Yasutake; Yamashita, Rina; Kaneko, Kiriko; Furuyama, Kazumichi. Novel Mechanisms for Heme-dependent Degradation of ALAS1 Protein as a Component of Negative Feedback Regulation of Heme Biosynthesis. The Journal Of Biological Chemistry. 2016;291(39):20516-29.  PubMed
Anderton, Brittany; Camarda, Roman; Balakrishnan, Sanjeev; Balakrishnan, Asha; Kohnz, Rebecca A; Lim, Lionel; Evason, Kimberley J; Momcilovic, Olga; Kruttwig, Klaus; Huang, Qiang; Xu, Guowang; Nomura, Daniel K; Goga, Andrei. MYC-driven inhibition of the glutamate-cysteine ligase promotes glutathione depletion in liver cancer. Embo Reports. 2017;18(4):569-585.  PubMed