Anti GLRX3 pAb (ATL-HPA028941)

Atlas Antibodies

SKU:
ATL-HPA028941-100
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
  • Western blot analysis in human cell line CACO-2.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glutaredoxin 3
Gene Name: GLRX3
Alternative Gene Name: bA500G10.4, GLRX4, GRX3, GRX4, PICOT, TXNL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031068: 94%, ENSRNOG00000016227: 94%
Entrez Gene ID: 10539
Uniprot ID: O76003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKA
Gene Sequence AEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKA
Gene ID - Mouse ENSMUSG00000031068
Gene ID - Rat ENSRNOG00000016227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLRX3 pAb (ATL-HPA028941)
Datasheet Anti GLRX3 pAb (ATL-HPA028941) Datasheet (External Link)
Vendor Page Anti GLRX3 pAb (ATL-HPA028941) at Atlas Antibodies

Documents & Links for Anti GLRX3 pAb (ATL-HPA028941)
Datasheet Anti GLRX3 pAb (ATL-HPA028941) Datasheet (External Link)
Vendor Page Anti GLRX3 pAb (ATL-HPA028941)