Anti GLRX pAb (ATL-HPA046431)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046431-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GLRX
Alternative Gene Name: GRX, GRX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021591: 97%, ENSRNOG00000012183: 97%
Entrez Gene ID: 2745
Uniprot ID: P35754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS |
Gene Sequence | IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS |
Gene ID - Mouse | ENSMUSG00000021591 |
Gene ID - Rat | ENSRNOG00000012183 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLRX pAb (ATL-HPA046431) | |
Datasheet | Anti GLRX pAb (ATL-HPA046431) Datasheet (External Link) |
Vendor Page | Anti GLRX pAb (ATL-HPA046431) at Atlas Antibodies |
Documents & Links for Anti GLRX pAb (ATL-HPA046431) | |
Datasheet | Anti GLRX pAb (ATL-HPA046431) Datasheet (External Link) |
Vendor Page | Anti GLRX pAb (ATL-HPA046431) |