Anti GLRA1 pAb (ATL-HPA016502)

Atlas Antibodies

Catalog No.: ATL-HPA016502-25

Protein Description: glycine receptor, alpha 1
Gene Name: GLRA1
Alternative Gene Name: STHE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000263: 96%, ENSRNOG00000013588: 95%
Entrez Gene ID: 2741
Uniprot ID: P23415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK
• Gene Sequence: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK
• Gene ID - Mouse: ENSMUSG00000000263
• Gene ID - Rat: ENSRNOG00000013588
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GLRA1 pAb (ATL-HPA016502) – 1 Found

McCracken, Lindsey; Zhang, Junxian; Greene, Maxwell; Crivaro, Anne; Gonzalez, Joyce; Kamoun, Malek; Lancaster, Eric. Improving the antibody-based evaluation of autoimmune encephalitis. Neurology(R) Neuroimmunology & Neuroinflammation. 2017;4(6):e404.