Anti GLMP pAb (ATL-HPA029121)

Atlas Antibodies

Catalog No.:
ATL-HPA029121-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycosylated lysosomal membrane protein
Gene Name: GLMP
Alternative Gene Name: C1orf85, MGC31963, NCU-G1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001418: 77%, ENSRNOG00000019281: 76%
Entrez Gene ID: 112770
Uniprot ID: Q8WWB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRT
Gene Sequence VSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRT
Gene ID - Mouse ENSMUSG00000001418
Gene ID - Rat ENSRNOG00000019281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLMP pAb (ATL-HPA029121)
Datasheet Anti GLMP pAb (ATL-HPA029121) Datasheet (External Link)
Vendor Page Anti GLMP pAb (ATL-HPA029121) at Atlas Antibodies

Documents & Links for Anti GLMP pAb (ATL-HPA029121)
Datasheet Anti GLMP pAb (ATL-HPA029121) Datasheet (External Link)
Vendor Page Anti GLMP pAb (ATL-HPA029121)