Anti GLMP pAb (ATL-HPA029121)

Atlas Antibodies

SKU: ATL-HPA029121-25

• 

Protein Description: glycosylated lysosomal membrane protein
Gene Name: GLMP
Alternative Gene Name: C1orf85, MGC31963, NCU-G1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001418: 77%, ENSRNOG00000019281: 76%
Entrez Gene ID: 112770
Uniprot ID: Q8WWB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRT
• Gene Sequence: VSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRT
• Gene ID - Mouse: ENSMUSG00000001418
• Gene ID - Rat: ENSRNOG00000019281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.